PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g042710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 574aa    MW: 65164 Da    PI: 5.3743
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g042710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS401.58.6e-1231995691374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     +++lL++cA+av+s d+++a + L++++e++s +gd++qRl  +++eAL+ar+++   +++  ++++ + ++++++ l+a+k f++++P+l++++
  Csa09g042710.1 199 MRDLLMQCAQAVASFDQSRAAEKLKEIREHSSIRGDATQRLGYHLAEALEARITG---TMATPISATYS-RTSMVDILKAYKGFVQACPTLRMCY 289
                     5799***************************************************...33333333333.4569********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +taN++I+e +++++++HiiDf+i +G+Q p+L+qaL++R++gpp lR+Tg++ p+sg   +e++eetg+rL++f+++++vpfe+++ +ak++ed
  Csa09g042710.1 290 FTANRTIYELASKATTLHIIDFGILYGFQLPCLIQALSNRDGGPPLLRVTGIELPQSGfrPSERVEETGRRLKRFCDKFKVPFEYSF-IAKNWED 383
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++l+eL +k+gE+++Vn++l+l++++de++sl+s+rd+vLkl+++++P+++v++e +  +ns+ Fl+rf eal ++salfd++ea+lp+e++ r+
  Csa09g042710.1 384 ITLDELVIKTGETTVVNCILRLQYTPDETMSLNSPRDTVLKLFRDINPDLFVFAEINGTYNSPFFLTRFREALFHCSALFDMYEATLPEEDNCRT 478
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vErel+ r++++v+aceg+er++r et+++W+ r+ +aGFkp++l++++ k ak ++++ + + + ++++++++++gWk+r L++vS+W+
  Csa09g042710.1 479 MVERELIVRDAMSVIACEGSERFARPETYKQWQVRILRAGFKPAKLNKEIIKHAKEIVKQRYHKDFVIDNDNHWMLQGWKGRVLYAVSCWK 569
                     **************************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.944173549IPR005202Transcription factor GRAS
PfamPF035143.0E-120199569IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MDAVLQVPVD GFKFENGSGS CCKPMNNLDE SCFTCFDESE SQSDSSSPTE SKVCSDYLPV  60
FKYINDMLME EDLEGQPCML VDSLALQAAE KSFYEVLQDQ SPPTSDQSSD VTGSPEVVSE  120
ESTRRYRHRD GDEDDYLEGG RKSKLPAIST MDELAEKYEE VLLICQKNTH GEASPNKTKP  180
AKGSSNRSKQ QKTEQPVDMR DLLMQCAQAV ASFDQSRAAE KLKEIREHSS IRGDATQRLG  240
YHLAEALEAR ITGTMATPIS ATYSRTSMVD ILKAYKGFVQ ACPTLRMCYF TANRTIYELA  300
SKATTLHIID FGILYGFQLP CLIQALSNRD GGPPLLRVTG IELPQSGFRP SERVEETGRR  360
LKRFCDKFKV PFEYSFIAKN WEDITLDELV IKTGETTVVN CILRLQYTPD ETMSLNSPRD  420
TVLKLFRDIN PDLFVFAEIN GTYNSPFFLT RFREALFHCS ALFDMYEATL PEEDNCRTMV  480
ERELIVRDAM SVIACEGSER FARPETYKQW QVRILRAGFK PAKLNKEIIK HAKEIVKQRY  540
HKDFVIDNDN HWMLQGWKGR VLYAVSCWKP AKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-422035698375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264190.0AK226419.1 Arabidopsis thaliana mRNA for scarecrow-like protein, complete cds, clone: RAFL06-09-N12.
GenBankAL1333140.0AL133314.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F12A12.
GenBankAY0874180.0AY087418.1 Arabidopsis thaliana clone 35201 mRNA, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010426098.10.0PREDICTED: scarecrow-like protein 30 isoform X1
SwissprotQ9SNB80.0SCL30_ARATH; Scarecrow-like protein 30
TrEMBLR0HF420.0R0HF42_9BRAS; Uncharacterized protein
STRINGscaffold_501562.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46600.10.0GRAS family protein